Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » BPC 5mg+TB 5mg
BPC 5mg+TB 5mg
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

BPC 5mg+TB 5mg

BB10
AUD$ 142.00
USD

BPC-157 5mg + TB-500 5mg (BB10) is a compound lyophilized product composed of two research peptides, primarily used for research on tissue repair, cell signaling, and regenerative biological mechanisms.

Key Specifications

  • Molecular Formula C₆₂H₉₈N₁₆O₂₂ C₂₁₂H₃₅₀N₅₆O₅₆S
  • Molecular Weight 1419.55 Da 4963.5 Da
  • Purity ≥99%
  • CAS Number 137525-51-0 77591-33-4
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 10mg*10 vials

Product Description

BB10 (BPC-157 5mg + TB-500 5mg) is a compound peptide research product composed of two bioactive peptides with different structures: BPC-157 and TB-500. BPC-157 is a 15-peptide compound, while TB-500 is derived from a research fragment related to thymosin β4. Because of their different molecular structures and research focuses, this compound product is often used to explore synergistic effects between peptides, cell migration mechanisms, tissue-related biological processes, and cell repair signaling pathways. The product is typically supplied as a white to off-white lyophilized powder and its quality is evaluated by HPLC and LC-MS.

Full Specifications

  • Product Name BPC 5mg+TB 5mg
  • CAS Number 137525-51-0 77591-33-4
  • Molecular Formula C₆₂H₉₈N₁₆O₂₂ C₂₁₂H₃₅₀N₅₆O₅₆S
  • Molecular Weight 1419.55 Da 4963.5 Da
  • Amino Acid Sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Purity (HPLC) ≥99%
  • Appearance White to off-white lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 24 months
  • Packaging 10mg*10 vials
  • Quality Standards Conform

Research Applications

BPC-157 + TB-500 (BB10) is primarily used in basic life sciences and regenerative medicine research. Researchers utilize this complex peptide to study cell migration, tissue repair mechanisms, angiogenesis-related signaling, inflammatory response mechanisms, and extracellular environment regulation. By combining two research peptides with different structures, it can be used to explore the potential impact of peptide complex systems on cell biological processes.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Acetate BPC-157

Acetate BPC-157BC10

Acetate BPC-157 (BC10) is a synthetic polypeptide research compound composed of ...

AUD$100.00 View Details →
BPC 10mg+TB 10mg

BPC 10mg+TB 10mgBB20

BPC-157 10mg + TB-500 10mg (BB20) is a compound research peptide product compose...

AUD$261.00 View Details →
TB-500(Thymosin β4 Acetate)

TB-500(Thymosin β4 Acetate)BT10

TB-500 (Thymosin β4 Acetate, BT10) is a thymosin β4-related research peptide u...

AUD$196.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us