Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » TB-500(Thymosin β4 Acetate)
TB-500(Thymosin β4 Acetate)
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

TB-500(Thymosin β4 Acetate)

BT10
AUD$ 196.00
USD

TB-500 (Thymosin β4 Acetate, BT10) is a thymosin β4-related research peptide used for research on cell migration, tissue biology, and cell signaling mechanisms.

Key Specifications

  • Molecular Formula C₂₁₂H₃₅₀N₅₆O₅₆S
  • Molecular Weight 4963.5 g/mol
  • Purity ≥99%
  • CAS Number 77591-33-4
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 10mg*10 vials

Product Description

TB-500 (Thymosin Beta-4 Acetate, BT10) is a synthetically produced thymosin β4-related peptide research product. Thymosin Beta-4 is a 43-amino acid protein fragment naturally found in various tissues, involved in cytoskeleton regulation, cell migration, and tissue-related biological processes. TB-500 is typically stable in acetate form and is supplied as a white to off-white lyophilized powder. This product is identified by HPLC purity analysis and LC-MS and is used for basic life science, cell biology, and molecular mechanism research.

Full Specifications

  • Product Name TB-500(Thymosin β4 Acetate)
  • CAS Number 77591-33-4
  • Molecular Formula C₂₁₂H₃₅₀N₅₆O₅₆S
  • Molecular Weight 4963.5 g/mol
  • Amino Acid Sequence MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Purity (HPLC) ≥99%
  • Appearance White to off-white lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 24 months
  • Packaging 10mg*10 vials
  • Quality Standards Conform

Research Applications

TB-500 (BT10) is primarily used in cell biology, tissue engineering, and research on regeneration-related mechanisms. Researchers utilize TB-500 to study cell migration processes, actin-related regulatory mechanisms, extracellular matrix interactions, angiogenesis-related signals, and changes in the tissue microenvironment. Furthermore, this peptide is also being used to explore the biological functions of thymosin β4 and its cell protection mechanisms.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Acetate BPC-157

Acetate BPC-157BC10

Acetate BPC-157 (BC10) is a synthetic polypeptide research compound composed of ...

AUD$100.00 View Details →
BPC 5mg+TB 5mg

BPC 5mg+TB 5mgBB10

BPC-157 5mg + TB-500 5mg (BB10) is a compound lyophilized product composed of tw...

AUD$142.00 View Details →
BPC 10mg+TB 10mg

BPC 10mg+TB 10mgBB20

BPC-157 10mg + TB-500 10mg (BB20) is a compound research peptide product compose...

AUD$261.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us