Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » Cagrilintide
Cagrilintide
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

Cagrilintide

CGL10
AUD$ 290.00
USD

Cagrilintide (CGL10) is a long-acting acylated amylin analogue research peptide used for research on amylin receptors, metabolic regulation, and peptide pharmacological mechanisms.

Key Specifications

  • Molecular Formula C₁₉₄H₃₁₂N₅₄O₅₉S₂
  • Molecular Weight 4409.01 g/mol
  • Purity ≥99%
  • CAS Number 1415456-99-3
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 10mg *10 vials

Product Description

Cagrilintide (CGL10) is a long-acting modified peptide based on optimized design of human amylin structure. Composed of 32 amino acids, its research value is enhanced through fatty acid chain modification. This molecule belongs to the amylin analogue family and can act on the amylin receptor (AMYR) and related receptor pathways, enabling the exploration of peptide structure, receptor interactions, and metabolic regulatory mechanisms. CGL10 is provided as a white to off-white lyophilized powder, and its quality was assessed by HPLC purity analysis and LC-MS identification.

Full Specifications

  • Product Name Cagrilintide
  • CAS Number 1415456-99-3
  • Molecular Formula C₁₉₄H₃₁₂N₅₄O₅₉S₂
  • Molecular Weight 4409.01 g/mol
  • Amino Acid Sequence KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
  • Purity (HPLC) ≥99%
  • Appearance White lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 12-24 months
  • Packaging 10mg *10 vials
  • Quality Standards Conform

Research Applications

Cagrilintide (CGL10) is primarily used in metabolic biology, endocrinology research, and peptide pharmacology. Researchers utilize this compound to study amylin receptor (AMYR) signaling, calmodulin receptor mechanisms, energy balance regulation, food intake regulation mechanisms, and the optimization of long-acting peptide structures. This compound can serve as a research tool to explore the mechanisms of action of amylin analogues in complex metabolic networks.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Retatrutide

Retatrutide RT10

Retatrutide (RT10) is a synthetic peptide research compound designed as a triple...

AUD$116.00 View Details →
Retatrutide

Retatrutide RT20

Retatrutide (RT20) is a novel synthetic modified peptide, with the research code...

AUD$216.00 View Details →
Retatrutide

Retatrutide RT30

Retatrutide RT30 is a 30mg research-grade peptide product of Retatrutide (LY3437...

AUD$289.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us