Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » Retatrutide
Retatrutide
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

Retatrutide

RT20
AUD$ 216.00
USD

Retatrutide (RT20) is a novel synthetic modified peptide, with the research code LY3437943. It belongs to the triple receptor agonist class, and research focuses primarily on metabolic regulation, receptor signaling pathways, and energy balance.

Key Specifications

  • Molecular Formula C₂₂₁H₃₄₂N₄₆O₆₈
  • Molecular Weight 4731.33 g/mol(Approximately 4731 Da)
  • Purity ≥99%
  • CAS Number 2381089-83-2
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 20mg*10 vials

Product Description

Retatrutide RT20 is a synthetic lipidated peptide research compound (LY3437943), designed as a triple receptor agonist targeting GLP-1R, GIPR, and glucagon receptor pathways. It is a 39-amino-acid modified peptide supplied as a white lyophilized powder for laboratory research applications.

Full Specifications

  • Product Name Retatrutide
  • CAS Number 2381089-83-2
  • Molecular Formula C₂₂₁H₃₄₂N₄₆O₆₈
  • Molecular Weight 4731.33 g/mol(Approximately 4731 Da)
  • Amino Acid Sequence YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS
  • Purity (HPLC) ≥99%
  • Appearance White lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life ≥24 months
  • Packaging 20mg*10 vials
  • Quality Standards Conform

Research Applications

Retatrutide (RT20 / LY3437943) is a synthetic lipidated peptide research compound primarily used in metabolic and peptide pharmacology studies. As a triple receptor agonist targeting GLP-1R, GIPR, and GCGR pathways, it is investigated for receptor signaling mechanisms, energy metabolism, glucose metabolism, lipid metabolism, peptide engineering, and pharmacokinetic research. Retatrutide serves as a valuable research tool for exploring multi-pathway metabolic regulation and the development of next-generation peptide-based compounds.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Retatrutide

Retatrutide RT10

Retatrutide (RT10) is a synthetic peptide research compound designed as a triple...

AUD$116.00 View Details →
Retatrutide

Retatrutide RT30

Retatrutide RT30 is a 30mg research-grade peptide product of Retatrutide (LY3437...

AUD$289.00 View Details →
Tirzepatide

Tirzepatide TR10

TR10 (Tirzepatide) is a dual receptor agonist research peptide used for metaboli...

AUD$87.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us