Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » Tirzepatide
Tirzepatide
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

Tirzepatide

TR10
AUD$ 87.00
USD

TR10 (Tirzepatide) is a dual receptor agonist research peptide used for metabolic signaling, receptor action mechanisms, and peptide pharmacology studies via GLP-1 and GIP receptor-related pathways.

Key Specifications

  • Molecular Formula C₂₂₅H₃₄₈N₄₈O₆₈S₂
  • Molecular Weight 4813.45 g/mol
  • Purity ≥99%
  • CAS Number 2023788-19-2
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 10mg*10 vials

Product Description

Tirzepatide TR10 is a synthetic modified peptide research compound composed of 39 amino acids, belonging to the GLP-1/GIP dual receptor agonist class. Its research value is enhanced through structural optimization and fatty acid modification, primarily for exploring the incretin receptor signaling pathway, metabolic regulatory mechanisms, and the development of novel multi-target peptide molecules. The product is typically supplied as a white to off-white lyophilized powder, and quality analysis is performed by HPLC purity determination and LC-MS identification.

Full Specifications

  • Product Name Tirzepatide
  • CAS Number 2023788-19-2
  • Molecular Formula C₂₂₅H₃₄₈N₄₈O₆₈S₂
  • Molecular Weight 4813.45 g/mol
  • Amino Acid Sequence YAEGTFTSDYSIYLDKQAQAFVQWLMNTKRNRNNIA
  • Purity (HPLC) ≥99%
  • Appearance White lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 12–24 months
  • Packaging 10mg*10 vials
  • Quality Standards Conform

Research Applications

Tirzepatide TR10 is primarily used in metabolic biology, receptor signaling research, and peptide pharmacology, including studies on the activation mechanism of the GLP-1R/GIPR dual receptor, cell signal transduction analysis, glucose metabolism, energy balance, receptor binding experiments, and the development of novel metabolic regulatory peptides. Researchers utilize this molecule to explore the synergistic effects of multiple receptors and the regulatory mechanisms of related metabolic pathways.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Retatrutide

Retatrutide RT10

Retatrutide (RT10) is a synthetic peptide research compound designed as a triple...

AUD$116.00 View Details →
Retatrutide

Retatrutide RT20

Retatrutide (RT20) is a novel synthetic modified peptide, with the research code...

AUD$216.00 View Details →
Retatrutide

Retatrutide RT30

Retatrutide RT30 is a 30mg research-grade peptide product of Retatrutide (LY3437...

AUD$289.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us