Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » Tirzepatide
Tirzepatide
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

Tirzepatide

TR20
AUD$ 128.00
USD

Tirzepatide TR20 is a synthetic modified peptide research compound used to study the metabolic mechanism, receptor function, and peptide pharmacology of the GLP-1 and GIP dual receptor-related signaling pathways.

Key Specifications

  • Molecular Formula C₂₂₅H₃₄₈N₄₈O₆₈S₂
  • Molecular Weight 4813.45 g/mol
  • Purity ≥99%
  • CAS Number 2023788-19-2
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 20mg*10vials

Product Description

Tirzepatide TR20 is a synthetic modified peptide compound consisting of 39 amino acids, belonging to the GLP-1/GIP dual receptor agonist class. This molecule, through structural optimization and fatty acid modification, is designed to investigate incretin-related receptor signaling pathways, the relationship between molecular structure and function, and multi-target metabolic regulatory mechanisms. The product is supplied as a white to off-white lyophilized powder, and its quality is evaluated by HPLC purity analysis and LC-MS identification.

Full Specifications

  • Product Name Tirzepatide
  • CAS Number 2023788-19-2
  • Molecular Formula C₂₂₅H₃₄₈N₄₈O₆₈S₂
  • Molecular Weight 4813.45 g/mol
  • Amino Acid Sequence YAEGTFTSDYSIYLDKQAQAFVQWLMNTKRNRNNIA
  • Purity (HPLC) ≥99%
  • Appearance White lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 12-24 months
  • Packaging 20mg*10vials
  • Quality Standards Conform

Research Applications

Tirzepatide TR20 is primarily used in metabolic biology, receptor signaling studies, and peptide pharmacology, including research on the activation mechanisms of GLP-1 and GIP receptors, cell signal transduction analysis, glucose metabolism, energy balance mechanisms, receptor binding experiments, and the optimization of novel peptide drug structures. This compound can serve as a research tool to explore the synergistic effects of dual receptors and related metabolic signaling networks.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Retatrutide

Retatrutide RT10

Retatrutide (RT10) is a synthetic peptide research compound designed as a triple...

AUD$116.00 View Details →
Retatrutide

Retatrutide RT20

Retatrutide (RT20) is a novel synthetic modified peptide, with the research code...

AUD$216.00 View Details →
Retatrutide

Retatrutide RT30

Retatrutide RT30 is a 30mg research-grade peptide product of Retatrutide (LY3437...

AUD$289.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us