Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » Glow(TB-500 10mg + BPC-157 10mg + GHK-Cu 50mg)
Glow(TB-500 10mg + BPC-157 10mg + GHK-Cu 50mg)
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

Glow(TB-500 10mg + BPC-157 10mg + GHK-Cu 50mg)

BBG70
AUD$ 254.00
USD

Glow (BBG70) is a complex research peptide product composed of TB-500, BPC-157 and GHK-Cu, used for cell repair, tissue-related mechanisms and skin biology research.

Key Specifications

  • Molecular Formula C₂₁₂H₃₅₀N₅₆O₅₆S C₆₂H₉₈N₁₆O₂₂ C₁₄H₂₄CuN₆O₄
  • Molecular Weight 4963.5 g/mol 1419.55 g/mol 401.96 g/mol
  • Purity ≥99%
  • CAS Number 77591-33-4 137525-51-0 49557-75-7
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 70mg*10 vials

Product Description

Glow (BBG70) is a compound research peptide lyophilized product composed of three components: TB-500 (10 mg), BPC-157 (10 mg), and GHK-Cu (50 mg). TB-500 is derived from the Thymosin β4 research system, BPC-157 is a 15-peptide research compound, and GHK-Cu is a naturally occurring copper-binding tripeptide complex. These three components have different molecular structures and research focuses, and can be used to explore the mechanisms of action of cell migration, tissue microenvironment, cell signaling, copper ion-related biological processes, and peptide complexes. The product is typically supplied in lyophilized powder form and its quality is evaluated using methods such as HPLC and LC-MS.

Full Specifications

  • Product Name Glow(TB-500 10mg + BPC-157 10mg + GHK-Cu 50mg)
  • CAS Number 77591-33-4 137525-51-0 49557-75-7
  • Molecular Formula C₂₁₂H₃₅₀N₅₆O₅₆S C₆₂H₉₈N₁₆O₂₂ C₁₄H₂₄CuN₆O₄
  • Molecular Weight 4963.5 g/mol 1419.55 g/mol 401.96 g/mol
  • Amino Acid Sequence MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES GEPPPGKPADDAGLV Gly-His-Lys
  • Purity (HPLC) ≥99%
  • Appearance Blue to white / off-white lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 24 months
  • Packaging 70mg*10 vials
  • Quality Standards Conform

Research Applications

Glow (BBG70) is primarily used in basic life sciences, cell biology, and tissue engineering research. Researchers can utilize this complex system to study cell migration mechanisms, extracellular matrix regulation, oxidative stress responses, copper-binding protein-related processes, skin cell biology, and tissue microenvironment regulation mechanisms. As a multi-component research model, this product can help investigate the potential roles of different peptides and metal-binding peptides in the regulation of cell function.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Acetate BPC-157

Acetate BPC-157BC10

Acetate BPC-157 (BC10) is a synthetic polypeptide research compound composed of ...

AUD$100.00 View Details →
BPC 5mg+TB 5mg

BPC 5mg+TB 5mgBB10

BPC-157 5mg + TB-500 5mg (BB10) is a compound lyophilized product composed of tw...

AUD$142.00 View Details →
BPC 10mg+TB 10mg

BPC 10mg+TB 10mgBB20

BPC-157 10mg + TB-500 10mg (BB20) is a compound research peptide product compose...

AUD$261.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us