Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » BPC-157 10mg + GHK-Cu 50mg + TB-500
BPC-157 10mg + GHK-Cu 50mg + TB-500
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

BPC-157 10mg + GHK-Cu 50mg + TB-500

KLOW80
AUD$ 261.00
USD

KLOW80 (BPC-157 + GHK-Cu + TB-500) is a compound research peptide formulation used for research on cell repair, tissue-related mechanisms, cell migration, and matrix regulation.

Key Specifications

  • Molecular Formula C₆₂H₉₈N₁₆O₂₂ C₁₄H₂₄CuN₆O₄ C₂₁₂H₃₅₀N₅₆O₅₆S
  • Molecular Weight 1419.55 g/mol 401.96 g/mol 4963.5 g/mol
  • Purity ≥99%
  • CAS Number 137525-51-0 49557-75-7 77591-33-4
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 80mg*10 vials

Product Description

KLOW80 is a compound research peptide lyophilized product composed of three bioactive peptides with different structures: BPC-157, GHK-Cu, and TB-500. BPC-157 is a short-chain peptide composed of 15 amino acids, GHK-Cu is a copper-bound tripeptide, and TB-500 is derived from the Thymosin Beta-4 research system. These three components have different molecular structures and research focuses, and can be used to explore the mechanisms of action of cell migration, extracellular matrix regulation, copper ion-related biological processes, tissue microenvironment, and peptide complex systems. The product is typically supplied in lyophilized powder form and its quality is confirmed using methods such as HPLC and LC-MS.

Full Specifications

  • Product Name BPC-157 10mg + GHK-Cu 50mg + TB-500
  • CAS Number 137525-51-0 49557-75-7 77591-33-4
  • Molecular Formula C₆₂H₉₈N₁₆O₂₂ C₁₄H₂₄CuN₆O₄ C₂₁₂H₃₅₀N₅₆O₅₆S
  • Molecular Weight 1419.55 g/mol 401.96 g/mol 4963.5 g/mol
  • Amino Acid Sequence GEPPPGKPADDAGLV Gly-His-Lys MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Purity (HPLC) ≥99%
  • Appearance White to blue lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 24 months
  • Packaging 80mg*10 vials
  • Quality Standards Conform

Research Applications

KLOW80 is primarily used in basic life sciences and cell biology research, including studies on cell migration mechanisms, tissue microenvironment regulation, extracellular matrix remodeling, copper-binding protein mechanisms, oxidative stress, and peptide synergistic effects. Research directions are mainly based on existing experimental data for each individual component, but the KLOW compound system itself still requires further systematic research and validation.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Acetate BPC-157

Acetate BPC-157BC10

Acetate BPC-157 (BC10) is a synthetic polypeptide research compound composed of ...

AUD$100.00 View Details →
BPC 5mg+TB 5mg

BPC 5mg+TB 5mgBB10

BPC-157 5mg + TB-500 5mg (BB10) is a compound lyophilized product composed of tw...

AUD$142.00 View Details →
BPC 10mg+TB 10mg

BPC 10mg+TB 10mgBB20

BPC-157 10mg + TB-500 10mg (BB20) is a compound research peptide product compose...

AUD$261.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us