Product Details

Premium Research Peptide - High Purity Guaranteed

Home » Products » IGF-1 LR3
IGF-1 LR3
≥99% Purity Guarantee
COA Available
Fast Shipping
Technical Support

IGF-1 LR3

IG1
AUD$ 261.00
USD

IGF-1 LR3 (IG1) is a long-acting insulin-like growth factor-1 analog used to study cell growth signaling, the IGF receptor pathway, and growth factor regulation mechanisms.

Key Specifications

  • Molecular Formula C₃₃₁H₅₁₆N₉₀O₉₉S₇
  • Molecular Weight 9118.6 Da
  • Purity ≥99%
  • CAS Number 946870-92-4
  • Storage Store at -20℃ ±5℃ Keep away from light
  • Specifications 1mg*10 vials

Product Description

IGF-1 LR3 (Long R3 IGF-1, IG1) is a structurally optimized insulin-like growth factor-1 (IGF-1) analog. This molecule improves the stability of native IGF-1 and alters its interaction with IGF-binding proteins by modifying its structure. Composed of 83 amino acids, IGF-1 LR3 is a growth factor research tool, typically supplied as a white to off-white lyophilized powder, and its quality is evaluated using HPLC purity analysis and LC-MS identification. This product is primarily used to explore IGF signaling pathways, cell proliferation mechanisms, and growth factor-related biological processes.

Full Specifications

  • Product Name IGF-1 LR3
  • CAS Number 946870-92-4
  • Molecular Formula C₃₃₁H₅₁₆N₉₀O₉₉S₇
  • Molecular Weight 9118.6 Da
  • Amino Acid Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPQKSQK
  • Purity (HPLC) ≥99%
  • Appearance White to off-white lyophilized powder
  • Solubility Completely dissolved
  • Storage Temperature Store at -20℃ ±5℃ Keep away from light
  • Shelf Life 24 months
  • Packaging 1mg*10 vials
  • Quality Standards Conform

Research Applications

IGF-1 LR3 is primarily used in basic life sciences, cell biology, and molecular mechanism research, including studies on IGF-1 receptor (IGF-1R) signaling, cell proliferation and differentiation mechanisms, growth factor regulatory networks, and protein-receptor interactions. Researchers utilize IGF-1 LR3 as an experimental tool to investigate the mechanisms of action of IGF-related pathways in different cell models, providing experimental references for growth factor regulation and cell function research.

Safety Information & Storage

Freeze-dried powder state:

Recommended:

Long-term storage:

-20℃

Requirements:

✅ Protect from light

✅ Dry

✅ Store in an airtight container

Avoid:

High temperatures
Repeated freeze-thaw cycles
Prolonged exposure to air

Related Products

Acetate BPC-157

Acetate BPC-157BC10

Acetate BPC-157 (BC10) is a synthetic polypeptide research compound composed of ...

AUD$100.00 View Details →
BPC 5mg+TB 5mg

BPC 5mg+TB 5mgBB10

BPC-157 5mg + TB-500 5mg (BB10) is a compound lyophilized product composed of tw...

AUD$142.00 View Details →
BPC 10mg+TB 10mg

BPC 10mg+TB 10mgBB20

BPC-157 10mg + TB-500 10mg (BB20) is a compound research peptide product compose...

AUD$261.00 View Details →

Need Bulk Order or Custom Synthesis?

Contact our team for volume discounts and custom peptide services

Contact Sales WhatsApp Us